Attention! Save Up to 40% off at Nordstrom's Winter Clearance Sale. Free Shipping. Free Returns. SHOP NOW Women Bags Shoes Beauty Jewelry Men Kids Home Offers Sale Editors' Blog Featured Looks

7 For All Mankind Women's Relaxed Jeans

113 Products
Sort

Free Shipping

7 For All Mankind Josefina Embroidered Distressed Boyfriend Jeans 7 For All Mankind Josefina Embroidered Distressed Boyfriend Jeans extended-info

Cropped, distressed jeans with floral embroidery. Belt loops. Zip fly with button closure. Five-pocket style. Cuffed hem. Rise, about 9".Inseam, about 25".Leg opening, about...

7 For All Mankind Fashion Boyfriend Jeans 7 For All Mankind Fashion Boyfriend Jeans extended-info

Frayed, inside-out cuffs give these faded 7 For All Mankind boyfriend jeans an undone finish. 5-pocket styling. Button closure and zip fly. Fabric: Stretch denim. 94%...

7 For All Mankind Josefina Destroyed Jeans 7 For All Mankind Josefina Destroyed Jeans extended-info

Relaxed 7 For All Mankind jeans in faded, shredded denim. 5-pocket styling. Button fly. Fabric: Soft stretch denim. 98% cotton/2% spandex. Wash cold or dry clean. Made...

7 For All Mankind Josefina Rolled Hem Jeans 7 For All Mankind Josefina Rolled Hem Jeans extended-info

Shredded holes and intense fading lend a favorite-pair feel to slouchy 7 For All Mankind boyfriend jeans. 5-pocket styling. Button fly. Fabric: Stretch denim. 98% cotton2%...

Free Shipping

7 For All Mankind Josefina Slim Boyfriend Jeans 7 For All Mankind Josefina Slim Boyfriend Jeans extended-info

These slightly distressed jeans approach the nonchalantly cool boyfriend silhouette with a lean, flattering slant. Belt loops. Button fly. Five-pocket style. Distressed detail....

7 For All Mankind Josefina Relaxed-Fit Distressed Jeans, Blue 7 For All Mankind Josefina Relaxed-Fit Distressed Jeans, Blue extended-info

7 For All Mankind "Josefina" jeans in stretch-denim with aggressive distressing. Approx. measurements: 9.5" front rise; 11.5" back rise; 26" inseam; 35" outseam; 5" leg opening....

7 For All Mankind Runway Wide-Leg Denim Culottes, Runaway White 7 For All Mankind Runway Wide-Leg Denim Culottes, Runaway White extended-info

7 For All Mankind "Runway" culottes in stretch denim. Four-pocket style. Natural rise. Relaxed wide legs. Cropped at mid calf. Button/zip fly; belt loops Cotton/spandex....

7 For All Mankind Josefina Relaxed-Fit Distressed Jeans, Blue 7 For All Mankind Josefina Relaxed-Fit Distressed Jeans, Blue extended-info

7 For All Mankind "Josefina" jeans in stretch-denim with aggressive distressing. Approx. measurements: 9.5" front rise; 11.5" back rise; 26" inseam; 35" outseam; 5" leg opening....

Free Shipping

7 For All Mankind Fashion Boyfriend Cuffed Jeans With Shadow Tux Stripe 7 For All Mankind Fashion Boyfriend Cuffed Jeans With Shadow Tux Stripe extended-info

Laidback boyfriend jeans with raw-edge cuffs. Belt loops. Zip fly with button closure. Five-pocket style. Raw-edge cuffs. Rise, about 10".Inseam, about 26".Leg opening, about...

7 For All Mankind Fashion Boyfriend Jeans 7 For All Mankind Fashion Boyfriend Jeans extended-info

Fashion Boyfriend Blue Jeans By 7 For All Mankind

7 For All Mankind Josefina Boyfriend Jeans 7 For All Mankind Josefina Boyfriend Jeans extended-info

Josefina Blue Boyfriend Jeans By 7 For All Mankind

7 For All Mankind Josefina Boyfriend Jeans 7 For All Mankind Josefina Boyfriend Jeans extended-info

Josefina Blue Boyfriend Jeans By 7 For All Mankind

7 For All Mankind Josefina Embroidered Botanical Relaxed Jeans, Indigo 7 For All Mankind Josefina Embroidered Botanical Relaxed Jeans, Indigo extended-info

7 For All Mankind "Josefina" jeans featuring embroidered floral motif. Approx. measurements: 7.5" front rise; 12.5" back rise; 27" inseam (includes 2" roll); 12.8" leg opening...

7 For All Mankind Josefina Slim Boyfriend Jeans, Bright Light Broken Twill 7 For All Mankind Josefina Slim Boyfriend Jeans, Bright Light Broken Twill extended-info

7 For All Mankind Josefina jeans in faded, distressed denim. Approx. measurements: 8" rise; 10" leg openings; 25" inseam, 33" outseam. Relaxed, straight legs. Cuffed above...

7 For All Mankind Josefina Distressed Slim Boyfriend Jeans, Indigo 7 For All Mankind Josefina Distressed Slim Boyfriend Jeans, Indigo extended-info

7 For All Mankind Josefina jeans in rich indigo denim with whiskering, fading, and distressing. Approx. measurements: 8" rise; 10" leg openings; 25" inseam, 33" outseam. Ripped...

7 For All Mankind Josephina Distressed Boyfriend Jeans with Pearly Details, Indigo 7 For All Mankind Josephina Distressed Boyfriend Jeans with Pearly Details, Indigo extended-info

ONLYATNM Only Here. Only Ours. Exclusively for You. 7 For All Mankind "Josephina" boyfriend-fit jeans with mixed pearly embellishments. Five-pocket style. Mid rise. Distressing,...

7 For All Mankind Women's Josefina with Destroy In Santorini Light Aqua 2 7 For All Mankind Women's Josefina with Destroy In Santorini Light Aqua 2 extended-info

Feminineboyfriendjeaninadestroyedlightbluewashfeaturingperfecthandsandingdetail,contrastbeigethreadsandbeautifulItalianhardware.

7 For All Mankind Women's the Fashion Boyfriend Jean with Wide Raw Cuff 7 For All Mankind Women's the Fashion Boyfriend Jean with Wide Raw Cuff extended-info

Feminineboyfriendfashionjeaninanauthenticmediumbluewashwithshadowsideseamdetails.Thisstylefeaturesexcellentstretch,handsanding,andwhickerswhichaddvisualinterest.Itiscompletewith...

7 For All Mankind Women's Josefina with Destroy Boyfriend Jean 7 For All Mankind Women's Josefina with Destroy Boyfriend Jean extended-info

Thefeminineboyfriendsilhouetteinthisclassicandcleanwhitewash.Thisauthenticwhitetwillisperfectfortheboyfriendfitandhasaddedvisualappealwithitsdestroyeddetails,tonalthreadsandsilv...

7 For All Mankind Women's Josefina Jean with Destroy in 7 For All Mankind Women's Josefina Jean with Destroy in extended-info

Feminineboyfriendjeaninanauthenticbrightmediumbluewash.Thisstylefeaturesgreatstretch,handsanding,andwhickerswhichaddvisualinterest.Itiscompletewithredlabelandcontrastgoldenthrea...

7 For All Mankind Women's Josefina W/ Destroy Jean in Bright Bluebell 7 For All Mankind Women's Josefina W/ Destroy Jean in Bright Bluebell extended-info

Thefeminineboyfriendinthisstunninglightbrightbluewash.Theauthenticalloverhandsandingandperfectlyplacedwhiskersatthethighsaddtothecoollook.Thereareuniqueholesatthethighsandkneesf...

7 For All Mankind Women's Josefina Boyfriend Jean 7 For All Mankind Women's Josefina Boyfriend Jean extended-info

Feminineboyfriendwithataperedlegopening.Featuresaslouchyfitthroughhipandthighandhasashorterinseamfortheperfectfit.

7 For All Mankind Women's Josefina Boyfriend Jean in Brillian 7 For All Mankind Women's Josefina Boyfriend Jean in Brillian extended-info

Arichbluehueisachievedonthisacomfortstretchbrokentwilldenim.Theperfectlyplacedwhiskers,chevronsandhandsandingaddedgetothisbeautifulwash.Thegenuinetwilllinesinthefabriccreatetext...

7 For All Mankind Women's Josefina Boyfriend Jean In 7 For All Mankind Women's Josefina Boyfriend Jean In extended-info

Boyfriendjean.Somedestructionanddistressingforavintagelook.

7 For All Mankind Women's Josefina in 7 For All Mankind Women's Josefina in extended-info

Ourbestselling,skinnyboyfriendisroomythroughthehipandthighandthentapersthroughthelegforamodernlook.Thislovelydarkbluewashhasaheritagenaturewhileremainingstrikingandsexy.Thedarkb...

7 For All Mankind Women's Josefina in 7 For All Mankind Women's Josefina in extended-info

Feminineboyfriendjeanwithanultra-softhandfeel.Featuressubtlehandsanding,tonalthreadsandbronzedhardware.

7 For All Mankind Women's Josefina in 7 For All Mankind Women's Josefina in extended-info

Ourbestselling,skinnyboyfriendisroomythroughthehipandthighandthentapersthroughthelegforamodernlook.Theacropolisdeepskywashisaperfectrichdarkbluewashthathasauthenticwhiskersandha...

7 For All Mankind Women's Relaxed Mid Roll Short W/ Destroy Jean in 7 For All Mankind Women's Relaxed Mid Roll Short W/ Destroy Jean in extended-info

Anauthenticrigiddenimistheperfectfabrictocreatethisvintageinspiredpiecethatiscoolandedgy.Thebrightmediumblueauthenticwashhashighsandlowscreatedbywhiskers,chevrons,handsandingand...

7 For All Mankind Women's Josefina Boyfriend Jean 7 For All Mankind Women's Josefina Boyfriend Jean extended-info

Thefeminineboyfriendsilhouetteinagorgeousandversatilestretchdeniminabeautifullyrichmediumcasthue.The3Dwhiskers,chevrons,andlocalhandsandinggivethiswashanauthenticeffectandgivesi...

7 For All Mankind Women's Josefina with Rolled Hem in 7 For All Mankind Women's Josefina with Rolled Hem in extended-info

Feminineboyfriendjeaninanultra-softtwillfabricfeaturingslighthandsandingandwhiskerdetail.Thisstyleiscompletewithbrighthardwareandtonalthreads.

7 For All Mankind Women's Josefina Boyfriend Jeans 7 For All Mankind Women's Josefina Boyfriend Jeans extended-info

Agorgeousandrichbluehueisachievedwithperfectlyplacedwhiskers,chevronsandhandsanding.Genuinetwilllinesinthefabriccreatetextureandaremarkablysofthandfeel.Spicebrownthreadsandgolde...

7 For All Mankind Women's Josefina Boyfriend Jean in 7 For All Mankind Women's Josefina Boyfriend Jean in extended-info

Askinnyboyfriendjeanthatisroomythroughthehipandthighandtapersthroughtheleg.Thepaloaltolightwasisasuperlightwashfortheseason.Thisstyleiscompletewithluxehardwareandwhickeringdetails.

7 For All Mankind Women's Josefina Boyfriend Jean in 7 For All Mankind Women's Josefina Boyfriend Jean in extended-info

Askinnyboyfriendjeanthatisroomythroughthehipandthighandtapersthroughtheleg.Oursunnyvalemediumheritageisarichindigobluewithhighsandlowsonthethighs,handsandingandwhiskerdetails.Th...

7 For All Mankind Women's Josefina Jean in 2 7 For All Mankind Women's Josefina Jean in 2 extended-info

Ourbestselling,skinnyboyfriendisroomythroughthehipandthighandthentapersthroughthelegforamodernlook.Thecreteislandisachievedononeofourpopularfabrics.Itisanexceptionalwashcombined...

7 For All Mankind Women's Josefina Jean with Destroy 7 For All Mankind Women's Josefina Jean with Destroy extended-info

Feminineboyfriendjeaninanauthenticlookingandvintageinspiredmediumbluewash.Thisstylefeaturesdestructionandhasgreatstretchandrecovery.Itiscompletewithbeautifulcontrastgoldenthread...

7 For All Mankind Women's Josefina with Rolled Hem in 7 For All Mankind Women's Josefina with Rolled Hem in extended-info

Feminineboyfriendjeaninanultra-softtwillfabricfeaturingslighthandsandingandwhiskerdetail.Thisstyleiscompletewithbrighthardwareandtonalthreads.

7 For All Mankind Women's Josefina with Aggressive Destroy 7 For All Mankind Women's Josefina with Aggressive Destroy extended-info

Authenticrigiddenimisusedtocreatethistrulyuniqueandspecialwashthatcaptivatesandintrigues.Themediumbluetoneistheperfectlandscapeforaggressivegrinding,handsanding,andchevrons.Adde...

7 For All Mankind Women's Josefina Boyfriend Jean with Rolled Hem in Authentic Medium Blue Dust 7 For All Mankind Women's Josefina Boyfriend Jean with Rolled Hem in Authentic Medium Blue Dust extended-info

Feminineboyfriendjeanwithkneeholesinabrightrichbluewashwithauthenticdetails.Thisstylefeaturesauthenticwhiskers,all-overhandsandingandkneebursts.Itiscompletewithbeautifulcontrast...

7 For All Mankind Women's Josefina Boyfriend Jean In 7 For All Mankind Women's Josefina Boyfriend Jean In extended-info

Feminineboyfriendsilhouetteinthisclassicandrichwashinastretchdenim.Perfectlyplacedwhiskersandhandsandinggivesthisbluewashapopalongwithitscontrastspicethreadsanddarkenedgoldhardw...