Attention! Save Up to 40% off at Nordstrom's Winter Clearance Sale. Free Shipping. Free Returns. SHOP NOW Women Bags Shoes Beauty Jewelry Men Kids Home Offers Sale Editors' Blog Featured Looks

Alpha Industries Women's Fashion

27 Products
Sort

Alpha Industries Women's MA-1 Reversible Flight Jacket Alpha Industries Women's MA-1 Reversible Flight Jacket extended-info

Fashioned after the jackets worn by 1950s U.S. Air Force and Navy pilots, Alpha Industries' MA-1 flight jacket is embroidered at the front and back with koi. The jacket reverses...

Alpha Industries Women's "Hawaii" Reversible Flight Jacket Alpha Industries Women's "Hawaii" Reversible Flight Jacket extended-info

Alpha Industries' flight jacket features two multicolored embroidered flowers at the front and red "Hawaii" lettering and a multicolored hula-girl motif at the back. The jacket...

Alpha Industries Women's MA-1 Reversible Flight Jacket Alpha Industries Women's MA-1 Reversible Flight Jacket extended-info

Fashioned after the jackets worn by 1950s U.S. Air Force and Navy pilots, Alpha Industries' MA-1 flight jacket is embroidered at the front and back with multicolored cherry...

Alpha Industries Nylon Coat W/ Faux Fur Coat Alpha Industries Nylon Coat W/ Faux Fur Coat extended-info

Non-detachable hood with faux fur trip. Front zip and button closure. One sleeve zip pocket. Two chest pockets. One front zip pocket. Two front snap button pockets . Embroidered...

Alpha Industries MA-1 Flight Jacket Alpha Industries MA-1 Flight Jacket extended-info

100% Nylon Lining: 100% Nylon Fill: 100% Polyester Imported

Alpha Industries Women's Ma-1 Flight Nylon Reversible Bomber Jacket Alpha Industries Women's Ma-1 Flight Nylon Reversible Bomber Jacket extended-info

Ourpopularma-1flightjacketisnowavailableforwomen.Amid-weightnylonwithwaterresistanceandscadsofversatility,thema-1navyfighterpilotjacketwasthefirstmilitaryflightjackettocrossover...

Alpha Industries Women's MA-1 Diamond Alpha Industries Women's MA-1 Diamond extended-info

ThealphaMA-1flightjacket,oftencopiedbutneverduplicated.Thisistheclassicjacketmadebyalphaindustriesforthemilitaryforover40years,issuedtoboththeU.S.Airforceandnavypilots.Thema-1di...

Free Ship & Free Return

Alpha Industries MA-1 Flight Jacket Alpha Industries MA-1 Flight Jacket extended-info

; Introduced by the mid-1950s, the MA-1 became the flight jacket of U.S. Air Force and Navy pilots and ground crew. An addition to the jacket in 1960 was the reversibility to...

Alpha Industries Women's Elyse Parka Coat Alpha Industries Women's Elyse Parka Coat extended-info

Wehavetakenourpopularwomen'sN-3Bandaddedsomeextrafeaturestocreateanupgradedlook.Theflightnylonshellhasapartialfauxrabbitliningthatgoesfromthewaisttothehood.Thesnorkelhoodhasarem...

Alpha Industries Women's Altitude Slim Fit Oxford Nylon Parka Alpha Industries Women's Altitude Slim Fit Oxford Nylon Parka extended-info

Ourpopularaltitudeparkahasbeenstyledforwomen.TheN-3B-inspired...

Alpha Industries Women's N-3B Slim Fit Flight Nylon Parka Alpha Industries Women's N-3B Slim Fit Flight Nylon Parka extended-info

Wetookourdurablecold-weatherparkaandcreatedaversionthat'sjustforladies.TheN-3Bhasaflightnylonshellwithcontrastnylonlining.Thefull-lengthstormflap,adjustablehoodandstormcuffsmake...

Alpha Industries 'MA-1' flight jacket Alpha Industries 'MA-1' flight jacket extended-info

Our women's reversible nylon flight jacket includes knit cuffs, collar and waistband, as well as a front zipper with storm flap for warmth. There are multiple snap-closure...

Alpha Industries 'MA-1' flight jacket Alpha Industries 'MA-1' flight jacket extended-info

Updated classic MA-1 flight jacket with a slimmer fit throughout the body and sleeves. Like its counterpart, the MA-1 Slim Fit has a flight nylon, water-resistant shell with...

Alpha Industries Women's J-4 Fishtail Puffer Anorak Alpha Industries Women's J-4 Fishtail Puffer Anorak extended-info

Constructedfromatough,rugged,lightweightfabricdesignedforusebytheusmilitary,thisjacketfeatures:warmquilteddetachablelining,detachableimitationfurtrimmedhood,pressstudandzippeddo...

Alpha Industries removable hoodie bomber jacket Alpha Industries removable hoodie bomber jacket extended-info

Black cotton removable hoodie bomber jacket from Alpha Industries.

Alpha Industries removable hoodie bomber jacket Alpha Industries removable hoodie bomber jacket extended-info

Grey removable hoodie bomber jacket from Alpha Industries.

Extra 20% Off: PREZ20

Alpha Industries MA-1 NASA Bomber Jacket with Patches Alpha Industries MA-1 NASA Bomber Jacket with Patches extended-info

Bomber jacket by Alpha Industries, Woven fabric, Padded lining, Baseball collar, Patch detail, Zip fastening, Functional pockets, Ribbed trims, Regular fit - true to size, Dry...

Alpha Industries MA-1 Bomber Jacket Alpha Industries MA-1 Bomber Jacket extended-info

We can't get enough of this militaryinspired bomber jacket from Alpha Industries and all the Top Gun vibes that come along with it. In roomy reversible nylon silhouette with...

Free Ship & Free Return

Alpha Industries Elyse Parka Alpha Industries Elyse Parka extended-info

; The first N-3B jackets were produced in the mid 1950s for USAF air crews who were assigned to transport troops in extremely cold climates. The long sage green jackets became...

Free Ship & Free Return

Alpha Industries M-65 Defender Field Coat Alpha Industries M-65 Defender Field Coat extended-info

; The M-65 field coat was first issued to the U.S. Armed Services in 1965 as a replacement for the M-51 field coat. The M-65 represented the culmination of field coat design,...

Free Ship & Free Return

Alpha Industries Altitude Parka Alpha Industries Altitude Parka extended-info

; The first N-3B jackets were produced in the mid 1950s for USAF air crews who were assigned to transport troops in extremely cold climates. The long sage green jackets became...

Extra 20% Off: PREZ20

Alpha Industries Arctic Bomber Jacket with Faux Fur Collar Alpha Industries Arctic Bomber Jacket with Faux Fur Collar extended-info

Bomber jacket by Alpha Industries, Durable nylon outer, Fully lined, Hooded collar with faux fur trim, Zip fastening, Functional pockets, Ribbed trims, Regular fit - true to...

Extra 20% Off: PREZ20

Alpha Industries MA-1 Longline Bomber Coat with Gold Zip Alpha Industries MA-1 Longline Bomber Coat with Gold Zip extended-info

Bomber jacket by Alpha Industries, Durable nylon outer, Fully lined, Ribbed collar and trims, Zip fastening, Functional pockets, Ribbed/Fitted trims, Regular fit - true to size,...

Extra 20% Off: PREZ20

Alpha Industries Explorer Parka Coat with Faux Fur Hood Alpha Industries Explorer Parka Coat with Faux Fur Hood extended-info

Parka by Alpha Industries, Smooth woven outer, Padded for extra warmth, Fully lined, Hooded neckline, Faux-fur trim, Zip fastening, Button placket, Drawstring waist, MA1 sleeve...

Extra 20% Off: PREZ20

Alpha Industries MA-1 VF Tonga Print Bomber Jacket Alpha Industries MA-1 VF Tonga Print Bomber Jacket extended-info

Bomber jacket by Alpha Industries, Printed woven outer, Fully lined, Ribbed collar and trims, Zip fastening, Functional pockets, Regular fit - true to size, Dry clean, 100%...