Petite

+ Save this search

Free Ship & Free Returns

Lafayette 148 New York Women's Divya Reversible Vest With Genuine Shearling Trim
Lafayette 148 New York Women's Divya Reversible Vest With Genuine Shearling Trim

Sophisticated with a sportive side, this oversized vest warmed with a wonderfully plush shearling collar reverses from signature Alpine fabric to quilted Finite Italian flannel. A leather tie belt defines the waist, ensuring a flattering fit no matter how it's worn. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Divya Reversible Vest With Genuine Shearling Trim. Style Number: 5439064. Available in stores.

Get Sale Alert

Free Shipping

Saint Laurent classic petite leopard print shirt
Saint Laurent classic petite leopard print shirt

Black and grey silk classic petite leopard print shirt from Saint Laurent featuring a pointed collar, a concealed front button placket, long sleeves, button cuffs and a curved hemline.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Vany Tweed Knit Top
St. John Women's Vany Tweed Knit Top

A sophisticated nod to mod, this bateau-neck top features three-quarter sleeves and contrast trim for a vintage vibe. Metallic threads and sequins add understated sparkle to the neutral tweed knit, making the look suitable for day or night. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Vany Tweed Knit Top. Style Number: 5348200. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Stretch Tech Twill Bomber
St. John Women's Stretch Tech Twill Bomber

Vibrant blue varsity stripes trim the collar, cuffs and hem of this athletic-inspired take on the of-the-moment bomber jacket. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Stretch Tech Twill Bomber. Style Number: 5349102. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Satin-Back Crepe Cape Top
St. John Women's Satin-Back Crepe Cape Top

Elegant cape sleeves sewn from satin-backed crepe add breezy movement to this alluring black top finished with a dusting of darkly glittering rhinestones designed to sparkle at night. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Satin-Back Crepe Cape Top. Style Number: 5379998. Available in stores.

Get Sale Alert

Extra 15% Off: HAPPY12TH

Terani Couture Sequined Sweetheart Strapless Mermaid Gown 1711P2594
Terani Couture Sequined Sweetheart Strapless Mermaid Gown 1711P2594

Capture the glamour as you walk on this stunning gorgeous Terani 1711P2594 gown. A strapless sweetheart bodice comes alive with strands of beaming accents that adorn the fitted length. A vivid mermaid flare extends at your legs with shirring and layers of fabric for a dimensional look and a full-length hemline. Turn yourself into a timeless beautiful goddess in this creation by Terani. Style: terani_1711P2594 Details: Sweetheart neckline, Strapless, Sequin and bead embellishments, Mermaid silhouette Fabric Content: 100% Polyester Length: Long Neckline: Sweetheart Waistline: Natural Colors: Ivory Sizes: 0-18 Silhouette Mermaid

Get Sale Alert

Free Ship & Free Returns

St. John Women's Embellished Liquid Satin Blouse
St. John Women's Embellished Liquid Satin Blouse

Shimmering hand-placed crystals illuminate the fluttery cape-like sleeves and split back of this radiant liquid satin blouse. Wear it with slim bottoms for a simple yet striking eveningwear look. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Embellished Liquid Satin Blouse. Style Number: 5348651. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Embellished Silk Chiffon Shell
St. John Women's Embellished Silk Chiffon Shell

St. John's attention to detail shines on this silk-chiffon shell that's elegantly hand-embellished with sparkling Swarovski crystals and pearly drops. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Embellished Silk Chiffon Shell. Style Number: 5348201. Available in stores.

Get Sale Alert

Free Shipping $50+

Atlantique Ascoli Petite Anémone Blouse - XS
Atlantique Ascoli Petite Anémone Blouse - XS

Asfarassleevelesstopsgo,thisoneisaselegantasitgets.Whilethecrisp-cottonbutton-downsilhouetteisdefinitelyontheboxyside,thedrawstringhem(amazingwithhigh-waistedjeans ,ruffledcollar,andrelaxeddropshoulderkeepthingsdecidedlyfeminine. 100%cottonDrycleanSizing:0=XS,I=S,II=M,III=LMadeinFrance.---AtlantiqueAscoliPetiteAnémoneBlouse-XS.

Get Sale Alert

Atlantique Ascoli Petite Anémone cotton blouse
Atlantique Ascoli Petite Anémone cotton blouse

The Petite Anemone Cotton Blouse from Atlantique Ascoli is a must-have addition to your wardrobe. With its ruffled collar, short sleeves, and row of small buttons, it's reminiscent of the renowned Victorian style of the French designer. Casual yet feminine and elegant, it pairs with slim fit, dark blue jeans and a pair of patent derbies, or with a raw denim skirt and sneakers for a on-trend look.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Chriag Sequin Knit Peplum Top
St. John Women's Chriag Sequin Knit Peplum Top

Shimmering sequins and a flattering, flared silhouette make this peplum top a sophisticated alternative to everyday separates. The sparkly knit is understated enough for day, but can be dressed up for evening. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Chriag Sequin Knit Peplum Top. Style Number: 5350068. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Grommet Embellished Stretch Cady Top
St. John Women's Grommet Embellished Stretch Cady Top

Polished metal grommets provide understated edge to a stretch-cady top eased by dolman sleeves and deep side vents. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Grommet Embellished Stretch Cady Top. Style Number: 5381288. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Stitch Print Stretch Silk Blouse
St. John Women's Stitch Print Stretch Silk Blouse

A graphic geometric print inspired by intricate stitches patterns this breezy stretch-silk crepe de Chine blouse styled with a draped, longline hem that layers beautifully. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Stitch Print Stretch Silk Blouse. Style Number: 5349109. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Ratan Tile Print Stretch Silk Top
St. John Women's Ratan Tile Print Stretch Silk Top

Bold tile patterning brings exotic flavor to a stretch-silk twill blouse finished with pajama-inspired piping and contrast mosaic-print cuffs. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Ratan Tile Print Stretch Silk Top. Style Number: 5382262. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Stretch Silk Double Georgette Blouse With Removable Scarf
St. John Women's Stretch Silk Double Georgette Blouse With Removable Scarf

An inspired addition to the modern woman's wardrobe, this stretch-silk blouse features a detachable tie that can be worn multiple ways-bowed, loosely draped or removed altogether. Contrast piping and split, flared cuffs complete the look with contemporary sophistication. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Stretch Silk Double Georgette Blouse With Removable Scarf. Style Number: 5381283. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Velvet Polka Dot Asymmetrical Blouse
St. John Women's Velvet Polka Dot Asymmetrical Blouse

Full of playful femininity, this chiffon blouse is textured with burnout velvet polka dots and frilled with a cascading asymmetrical ruffle. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Velvet Polka Dot Asymmetrical Blouse. Style Number: 5383344. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Fil Coupe Lace-Up Tunic
St. John Women's Fil Coupe Lace-Up Tunic

Soft fringe and neat ribbing richly texture a tassel-tipped lace-up tunic spun with a touch of cashmere for a softer hand feel. Dropped shoulders and side vents relax the bohemian-chic look. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Fil Coupe Lace-Up Tunic. Style Number: 5350318. Available in stores.

Get Sale Alert

Free Ship & Free Returns

Lafayette 148 New York Women's Cultivated Crepe Jersey Duster
Lafayette 148 New York Women's Cultivated Crepe Jersey Duster

Crafted from fluid Italian crepe jersey with a knit shawl collar, this open-front duster has a long, relaxed drape that effortlessly layers over any look. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Cultivated Crepe Jersey Duster. Style Number: 5364896. Available in stores.

Get Sale Alert

Free Ship & Free Returns

Lafayette 148 New York Women's Sabel Patchwork Silk Blouse
Lafayette 148 New York Women's Sabel Patchwork Silk Blouse

Mixed graphic prints create a globally inspired patchwork effect on a button-up blouse tailored from featherweight Italian silk. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Sabel Patchwork Silk Blouse. Style Number: 5439053. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Silk Asymmetrical Ruffle Blouse
St. John Women's Silk Asymmetrical Ruffle Blouse

An asymmetrical ruffle softly cascades down this silk-georgette blouse, left semi-sheer at the sleeves to add to the sophisticated allure. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Silk Asymmetrical Ruffle Blouse. Style Number: 5350703. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Grommet Detail Denim Shirt
St. John Women's Grommet Detail Denim Shirt

Two-tone color blocking modernizes this yarn-dyed denim shirt in an oversized, borrowed-from-the-boys fit. Side pockets and grommet-laced tie cuffs supply a fashionably chic finish. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Grommet Detail Denim Shirt. Style Number: 5350306. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Silk Georgette Blouse
St. John Women's Silk Georgette Blouse

Delicate lace trim and semi-sheer sleeves give this easy silk-chiffon blouse an elegant look that goes from day to evening. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Silk Georgette Blouse. Style Number: 5352755. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Bell Sleeve High/low Oxford Shirt
St. John Women's Bell Sleeve High/low Oxford Shirt

Split bell cuffs add fashionable flair to a classic button-front tailored with a longer length that tucks perfectly into bottoms. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Bell Sleeve High/low Oxford Shirt. Style Number: 5383212. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Jaipur Tile Print Stretch Silk Blouse
St. John Women's Jaipur Tile Print Stretch Silk Blouse

Subtly inspired by a global market bazaar, this breezy stretch-silk blouse features an geometric tile motif based on beautifully intricate Indian textiles. Tassel trim along the sleeves enhances the artisanal feel. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Jaipur Tile Print Stretch Silk Blouse. Style Number: 5352787. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Liquid Satin Cocoon Top
St. John Women's Liquid Satin Cocoon Top

Softly fluid Japanese satin eases the relaxed cocoon silhouette-a new shape for St. John-of this V-neck blouse. Batwing sleeves and a flowy back pleat further augment the slouchy drape. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Liquid Satin Cocoon Top. Style Number: 5383003. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Medallion Fil Coupe Top
St. John Women's Medallion Fil Coupe Top

A fil coupe medallion motif brings far-flung influence to a breezy top trimmed in delicate pom lace that furthers the bohemian charm. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Medallion Fil Coupe Top. Style Number: 5350681. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Matte Shine Weave Knit Tunic
St. John Women's Matte Shine Weave Knit Tunic

Mixed-directional weaving and an asymmetrical hem put a modern slant on a relaxed tunic custom-dyed in a vivid color that emboldens the sharp, clean lines. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Matte Shine Weave Knit Tunic. Style Number: 5351398. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Back Bow Stretch Silk Blouse
St. John Women's Back Bow Stretch Silk Blouse

A blousy black bow adds playful detail to the back of this beautifully draped blue silk blouse styled with split sleeves that add evening-ready drama to the silhouette. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Back Bow Stretch Silk Blouse. Style Number: 5348665. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Bow Shoulder Liquid Satin Blouse
St. John Women's Bow Shoulder Liquid Satin Blouse

Pretty bows-each hand-embellished with sparkling crystals-cap the shoulders of a blouse that's equal parts polished and charming. The densely woven satin fabric boasts a soft luster and double-faced construction that feels as luxe as it looks. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Bow Shoulder Liquid Satin Blouse. Style Number: 5345635. Available in stores.

Get Sale Alert

Free Ship & Free Returns

Lafayette 148 New York Women's Desra Highgate Houndstooth Silk Tunic
Lafayette 148 New York Women's Desra Highgate Houndstooth Silk Tunic

Using the signature colors of the season, this Italian-silk tunic blouse gives classic houndstooth a boldly graphic refresh. Wide button cuffs can be turned back for a more relaxed look, and a longer length allows for styling with both dressy and casual bottoms. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Desra Highgate Houndstooth Silk Tunic. Style Number: 5424701. Available in stores.

Get Sale Alert

Extra 15% Off: HAPPY12TH

Mon Cheri Montage by Mon Cheri - 114903 Dress
Mon Cheri Montage by Mon Cheri - 114903 Dress

Please refer to Montage The Ivonne D Collection Size Chart. Two-piece shantung suit, strapless sheath with softly curved neckline, hand-beaded lace bodice with center beaded belt at natural waist, slim skirt with center back slit, matching bolero jacket with three-quarter length sleeves, suitable for the mother of the bride or the mother of the groom. Removable straps included.

Get Sale Alert

Free Ship & Free Returns

Lafayette 148 New York Women's Jolet Knit Trim Blouse
Lafayette 148 New York Women's Jolet Knit Trim Blouse

Tiny sequins illuminate the neckline of a relaxed silk blouse that looks elegant on its own or subtly sparkling from beneath layers. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Jolet Knit Trim Blouse. Style Number: 5367118. Available in stores.

Get Sale Alert

Free Ship & Free Returns

Lafayette 148 New York Women's Desra Renaissance Paisley Devore Blouse
Lafayette 148 New York Women's Desra Renaissance Paisley Devore Blouse

The Lafayette 148 New York fall collection was full of beautifully textured fabrics, like the semi-sheer one used on this bell-sleeve blouse, which is swirling with ornate burnout paisley. Fine details, another key element of the season, include ball-chain trim along the neckline and knotted ties at the split cuffs. Brand: LAFAYETTE 148. Style Name:Lafayette 148 New York Desra Renaissance Paisley Devore Blouse. Style Number: 5420400. Available in stores.

Get Sale Alert

Free Shipping $150+

Lafayette 148 New York Abbot Silk Blouse
Lafayette 148 New York Abbot Silk Blouse

No need for a necklace: The beautifully beaded neckline of this effortless Lafayette 148 New York silk topper adds luster to day and evening looks. Fits true to size, order your normal size Beaded boat neck, draped three-quarter length sleeves Sharkbite hem, pullover style Silk Dry clean Imported

Get Sale Alert

Free Shipping $150+

Lafayette 148 New York Nessa Floral Ribbed Velvet Top
Lafayette 148 New York Nessa Floral Ribbed Velvet Top

Combining the casual-cool styling of a sweatshirt with the luxe feel of silk-blend fabric, this floral top from Lafayette 148 New York adds a plush touch to your fall lineup. Fits true to size, order your normal size Round neck with solid trim, three-quarter sleeves Allover floral print, ribbed velvet Solid ribbed knit cuffs and hem Lined, pullover style Viscose/silk; lining: polyester; trim: viscose Dry clean Imported

Get Sale Alert

Free Shipping $150+

Lafayette 148 New York Brayden Stripe Blouse
Lafayette 148 New York Brayden Stripe Blouse

Vertical stripes and a modern mandarin collar lend to the sleek sophistication of this Lafayette 148 New York, while sumptuous silk ups the luxe factor. Fits true to size, order your normal size Mandarin collar, long sleeves, button cuffs Concealed button front, side slits at hem Silk Dry clean Imported

Get Sale Alert

Free Shipping $150+

Lafayette 148 New York Sidra Bell-Sleeve Blouse
Lafayette 148 New York Sidra Bell-Sleeve Blouse

Delicate blossoms adorn this luxe silk blouse from Lafayette 148 New York, while fluttery bell sleeves provide a trend-right finish. Fits true to size, order your normal size Round neck, three-quarter bell sleeves Back keyhole with button closure, center back seam Straight hem, allover floral print Silk Dry clean Imported

Get Sale Alert

Free Ship & Free Returns

St. John Women's Stretch Silk Charmeuse Halter Tie Blouse
St. John Women's Stretch Silk Charmeuse Halter Tie Blouse

Bright color and an oversized, tied bow add a playfully sophisticated look to this lustrous stretch-silk charmeuse blouse. Wear it to the office layered beneath suiting or style with denim for an evening out. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Stretch Silk Charmeuse Halter Tie Blouse. Style Number: 5352753. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Devika Tile Techno Stretch Cotton Shirt
St. John Women's Devika Tile Techno Stretch Cotton Shirt

St. John reimagines the staple white blouse with refined touches like diamond-jacquard cuffs for a bit of graphic contrast. Techno stretch-cotton shirting offers crisp yet easy structure, while an adjustable drawstring provides waist-defining shape. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Devika Tile Techno Stretch Cotton Shirt. Style Number: 5350307. Available in stores.

Get Sale Alert

Free Ship & Free Returns

St. John Women's Satin Back Crepe Shell
St. John Women's Satin Back Crepe Shell

Soft pleats and gathers along the neckline give elegant dimension to a sleeveless blouse that serves as an essential layering piece. The lightweight crepe fabrication features smooth satin on the reverse that feels wonderfully cool against the skin. Brand: ST. JOHN COLLECTION. Style Name:St. John Collection Satin Back Crepe Shell. Style Number: 5382209. Available in stores.

Get Sale Alert
Top