Enjoy up to 50% Off Select Spring Styles at BaubleBar! SHOP NOW Women Bags Shoes Beauty Jewelry Men Kids Home Offers Sale Editors' Blog Featured Looks

BCBGMAXAZRIA Women's Shorts

74 Products
Sort

Free Shipping $150+

BCBGMAXAZRIA Lindee Paisley-Print Romper BCBGMAXAZRIA Lindee Paisley-Print Romper More Info Product cell

A split neckline and paisley motif create a head-turning effect on this breezy one-and-done design from BCBGMAXAZRIA. Fits true to size, order your normal size; if between sizes, order one size up Split neckline, three-quarter sleeves, front button-and-loop closure Elasticized waist, two side slit pockets, allover paisley print Model measurements: 5'10" height, 33.5" bust, 23.5" waist, 34.5" hips, wearing a size extra small Polyester Machine wash Imported

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Alyx Vest Romper BCBGMAXAZRIA Women's Alyx Vest Romper More Info Product cell

Foranewtakeontheromper,thisminisilhouettehitsatthemid-thighandisfinishedwithtouchesofalluringlace.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Danae Romper BCBGMAXAZRIA Women's Danae Romper More Info Product cell

Experiencetheeasyfeelofalightweightcreperomperwithrefreshingblossomsandroomysleevesforabohemian-chicvibe.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Maddison Flyaway Back Romper BCBGMAXAZRIA Women's Maddison Flyaway Back Romper More Info Product cell

Thissleevelessromperispoisedforeveningadventureandsetsthetonewithslashpockets,bandedwaist,andattention-grabbingrearflyawaysheerpanels.

Zoom
Bell Get Sale Alert

Free Shipping & Returns

BCBGMAXAZRIA Collared Romper BCBGMAXAZRIA Collared Romper More Info Product cell

Founded in 1989, BCBGMAXAZRIA is the vision of one man: founder, designer, chairman and CEO Max Azria. Named for the French phrase bon chic, bon genre, a Parisian slang meaning good style, good attitude, the brand embodies a true combination of European sophistication and American spirit. The collection is a resulting line of directional, sophisticated designs in the most luxurious fabrics. Celebrities such as Angelina Jolie, Sarah Michelle Gellar, Rachel Bilson and Eva Mendes amongst many others, are huge fans of the brand. 100% cotton Button front closures Side slit pockets Back storm flap with pleat detail.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Giulianna BCBGMAXAZRIA Women's Giulianna More Info Product cell

Indulgeintheallureofthisfigure-skimmingsilhouette,showcasingastatementopenbackwithluxelacetrim.

Zoom
Bell Get Sale Alert

Free Shipping & Returns

BCBGMAXAZRIA Isla Romper BCBGMAXAZRIA Isla Romper More Info Product cell

Founded in 1989, BCBGMAXAZRIA is the vision of one man: founder, designer, chairman and CEO Max Azria. Named for the French phrase bon chic, bon genre, a Parisian slang meaning good style, good attitude, the brand embodies a true combination of European sophistication and American spirit. The collection is a resulting line of directional, sophisticated designs in the most luxurious fabrics. Celebrities such as Angelina Jolie, Sarah Michelle Gellar, Rachel Bilson and Eva Mendes amongst many others, are huge fans of the brand. Self & Lining: 100% poly Pleated front detail Elasticized waist Side slant pockets Open back with snap button closure Body measures approx 33.5" in lengthLeg opening measures approx 26".

Zoom
Bell Get Sale Alert

Free Shipping

BCBGMAXAZRIA Floral-Print Crisscross Romper BCBGMAXAZRIA Floral-Print Crisscross Romper More Info Product cell

Floral crepe romper with crisscross halter neckline. Halterneck. Sleeveless. Blouson bodice. Elasticized waist. Concealed side zip. Lined. Inseam, about 2".About 30" from shoulder to hem. Polyester. Machine wash. Imported. Model shown is 5'10" (177cm) wearing US size Small.

Zoom
Bell Get Sale Alert

Free Shipping

BCBGMAXAZRIA Printed Tank Romper BCBGMAXAZRIA Printed Tank Romper More Info Product cell

Edgy romper crafted in a slightly relaxed silhouette. Halter straps. Split V-neck. Sleeveless. Elasticized waist. Back button and loop closure. About 20" from shoulder to hem. Rise, about 10".Inseam, about 3".Polyester. Machine wash. Imported. Model shown is 5'10" (177cm) wearing US size Small.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Casli Romper BCBGMAXAZRIA Women's Casli Romper More Info Product cell

Inastatement,woodblockmedallionprintatopsmoothcrepe,thisrelaxedone-pieceisreimaginedwithatwistedhalternecklineandexposedopenback-perfectforsoakingupthesun.

Zoom
Bell Get Sale Alert

Up To 20% Off: MOM

BCBGMAXAZRIA Tyra Scarf Print Halter Short Jumpsuit BCBGMAXAZRIA Tyra Scarf Print Halter Short Jumpsuit More Info Product cell

BCBGMAXAZRIATyra Scarf Print Halter Short Jumpsuit

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Melanie BCBGMAXAZRIA Women's Melanie More Info Product cell

Fashionmeetsfunctionwiththisrelaxed-fitplaysuit,completewithconvenientpockets,shoulderepauletsandbuckledcollar.

Zoom
Bell Get Sale Alert

Up to 50% off! Free Ship

BCBGMAXAZRIA Aimee Romper BCBGMAXAZRIA Aimee Romper More Info Product cell

Founded in 1989, BCBGMAXAZRIA is the vision of one man: founder, designer, chairman and CEO Max Azria. Named for the French phrase bon chic, bon genre, a Parisian slang meaning good style, good attitude, the brand embodies a true combination of European sophistication and American spirit. The collection is a resulting line of directional, sophisticated designs in the most luxurious fabrics. Celebrities such as Angelina Jolie, Sarah Michelle Gellar, Rachel Bilson and Eva Mendes amongst many others, are huge fans of the brand. Self: 77% triacetate, 23% polyLining: 100% poly Ruffle trim Elastic waist Button cuffed sleeves Front slant pockets Back cut-out with top button closures Body measures approx 31" in lengthSleeve measures approx 25" in lengthLeg opening measures approx 24".

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Lilli Lace Boxing Short BCBGMAXAZRIA Women's Lilli Lace Boxing Short More Info Product cell

Luxeflorallaceisbalancedwithaneasystretchwaistbandandpracticalslashpocketstoperfectlycombinecasualandchic.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Gabi Bell Sleeve Romper BCBGMAXAZRIA Women's Gabi Bell Sleeve Romper More Info Product cell

Widebellsleevesandunderstatedlacetrimlendthisone-pieceabohemian-luxetouchthatwilltakeyoufromdaytonight.

Zoom
Bell Get Sale Alert

Free Shipping & Returns

BCBGMAXAZRIA Lilli Short BCBGMAXAZRIA Lilli Short More Info Product cell

Founded in 1989, BCBGMAXAZRIA is the vision of one man: founder, designer, chairman and CEO Max Azria. Named for the French phrase bon chic, bon genre, a Parisian slang meaning good style, good attitude, the brand embodies a true combination of European sophistication and American spirit. The collection is a resulting line of directional, sophisticated designs in the most luxurious fabrics. Celebrities such as Angelina Jolie, Sarah Michelle Gellar, Rachel Bilson and Eva Mendes amongst many others, are huge fans of the brand. Self: 62% nylon, 38% rayonContrast & Lining: 100% poly Elasticized waist Side slant pockets Lace overlay throughout Shorts measure approx 12" in length.

Zoom
Bell Get Sale Alert

Free Shipping

BCBGMAXAZRIA Lace Shorts BCBGMAXAZRIA Lace Shorts More Info Product cell

Intricate floral lace defines this comfortable pair. Elasticized waist. Slash pockets. Lined. Rise, about 12".Inseam, about 2".Nylon/rayon. Dry clean Imported. Model shown is 5'10" (177cm) wearing US size Small.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Camryn Metallic Short BCBGMAXAZRIA Women's Camryn Metallic Short More Info Product cell

Eye-catchinginsatinbackcrepewithametallicfoilfinish,thisflatteringhigh-riseshortisaspracticalasitischicwithfrontandbackpockets.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Codie Skort BCBGMAXAZRIA Women's Codie Skort More Info Product cell

Barethoselegsknowingthiscomfortablychicskortisstylishlyamplifyingtheirhard-workedbeauty.

Zoom
Bell Get Sale Alert

Up to 50% off! Free Ship

BCBGMAXAZRIA Joleen Romper BCBGMAXAZRIA Joleen Romper More Info Product cell

Founded in 1989, BCBGMAXAZRIA is the vision of one man: founder, designer, chairman and CEO Max Azria. Named for the French phrase bon chic, bon genre, a Parisian slang meaning good style, good attitude, the brand embodies a true combination of European sophistication and American spirit. The collection is a resulting line of directional, sophisticated designs in the most luxurious fabrics. Celebrities such as Angelina Jolie, Sarah Michelle Gellar, Rachel Bilson and Eva Mendes amongst many others, are huge fans of the brand. Self: 77% triacetate, 23% polyContrast & Lining: 100% poly Front button closure Side seam pockets Back hidden zipper with snap button closure Neck tie Long sleeves with button strap closures Body measures approx 30" in lengthSleeve measures approx 24" in lengthLeg opening measures approx 30".

Zoom
Bell Get Sale Alert

Free Ship $99+: SHIP99

BCBGMAXAZRIA Nancy Paisley Short Jumpsuit BCBGMAXAZRIA Nancy Paisley Short Jumpsuit More Info Product cell

Sleek jumpsuit styled in polished paisley Roundneck Lace-up detail Long sleeves Inseam, about 2" About 32" from shoulder to hem Polyester/crepe Dry clean Imported Model shown is 5'10" (177cm) wearing US size Small.

Zoom
Bell Get Sale Alert

Free Shipping $150+

BCBGMAXAZRIA Clarence Capelet Striped Romper BCBGMAXAZRIA Clarence Capelet Striped Romper More Info Product cell

Fits true to size, order your normal size; if between sizes, order one size up Point collar, long sleeves, button cuffs Partial front button placket, zip fly with hook-and-bar closure Two front slit pockets, attached capelet at back yoke and sleeves Model measurements: 5'10" height, 33.5" bust, 23.5" waist, 34.5" hips, wearing a size extra small Cotton Machine wash or dry clean Imported

Zoom
Bell Get Sale Alert

Up To 20% Off: MOM

BCBGMAXAZRIA Clarence Striped Cape Short Jumpsuit BCBGMAXAZRIA Clarence Striped Cape Short Jumpsuit More Info Product cell

BCBGMAXAZRIAClarence Striped Cape Short Jumpsuit

Zoom
Bell Get Sale Alert

Free Shipping $99+: SHIP99

BCBGMAXAZRIA Printed Lace Up Romper BCBGMAXAZRIA Printed Lace Up Romper More Info Product cell

Woven romper Graphic print throughout Crewneck Lace up front Elasticized waist Tonal topstitching and panel seaming Back keyhole with button closure Fully lined Measurements: 36" in circumference at bust; 31" from shoulder to hem; taken from a size S Model's height is 5 feet 9 inches" material="100% polyester" origin="China"

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Pia Casual Short BCBGMAXAZRIA Women's Pia Casual Short More Info Product cell

Featuringslashpocketsandaflatteringhighrise,thispontepairmakeseasygoingdressingeffortless.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Soren Printed Long Sleeve Romper BCBGMAXAZRIA Women's Soren Printed Long Sleeve Romper More Info Product cell

Analloversnakeprintonultra-smoothgeorgette,adjustablelongsleeves,andacomfortablestretchwaistbandelevateuptheeaseofthisminione-pieceforweekendchic.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Isacc Printed Short BCBGMAXAZRIA Women's Isacc Printed Short More Info Product cell

Aminishortwithageometricprintincolor-blockedhuesofaqua,bluemistandbrightpink.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Nancie Printed Romper BCBGMAXAZRIA Women's Nancie Printed Romper More Info Product cell

Evokeacasual-chicattitudeinthispeasantromper,decoratedwithafolk-inspiredprintforaneye-catchingfinish.

Zoom
Bell Get Sale Alert

Free Ship $99+: SHIP99

BCBGMAXAZRIA Urban Jungle Banks Cargo Romper BCBGMAXAZRIA Urban Jungle Banks Cargo Romper More Info Product cell

From the Urban Jungle Collection Classic cargo romper adds a utilitarian vibe Mandarin collar Shoulder epaulettes Button cuffed sleeves Front button closure Chest patch pockets Waist slash pockets Back box pleated yoke Back shirttail hem Folded hem About 18" from shoulder to hem Rise, about 11" Inseam, about 6" Lyocell twill Machine wash Imported Model shown is 5'10" (177cm) wearing US size 4.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Angella Wrap Back Romper BCBGMAXAZRIA Women's Angella Wrap Back Romper More Info Product cell

Wardofffashionfatiguewiththismischievouslycuteromper'swrap-backsilhouette.

Zoom
Bell Get Sale Alert

Free Shipping any 2+ items

BCBGMAXAZRIA Angella Wrap Back Romper BCBGMAXAZRIA Angella Wrap Back Romper More Info Product cell

You're femininely flawless in this lovely BCBGMAXAZRIA romper. ; Lightweight georgette constructs this lovely romper. ; Round neckline and short sleeves. ; Wrap-style back with delicate strap that snaps. ; Elasticized waist with drawstring closure. ; Dual hand pockets. ; 100% polyester. ; Machine wash cold, tumble dry low. ; Imported. Measurements: ; Inseam: 2 1 4 in ; Product measurements were taken using size XS (US 2). Please note that measurements may vary by size.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Franko Short BCBGMAXAZRIA Women's Franko Short More Info Product cell

Yourneweveryday,anywheredenimhigh-riseshortswithanabovethekneecutofflength.

Zoom
Bell Get Sale Alert

Free Ship $99+: SHIP99

BCBGMAXAZRIA Long Sleeve Ruffle Front Romper BCBGMAXAZRIA Long Sleeve Ruffle Front Romper More Info Product cell

Solid romper with alluring ruffle front details Ruffled mockneck Shoulder button closure Long sleeves with buttoned cuffs Elasticized waist Keyhole back with button closure Back slit Lined Rise, about 32" Inseam, about 3" About 32" from shoulder to hem Triacetate/polyester Machine wash Imported Model shown is 5'10" (177cm) wearing US size Small.

Zoom
Bell Get Sale Alert

Free Shipping $100+

BCBGMAXAZRIA Soren Romper BCBGMAXAZRIA Soren Romper More Info Product cell

V-neck Long sleeves with button pull tabs Back keyhole with button closure Elasticized waist 2 front slash pockets Approx. 31" full length, 2.5" inseam (size S) Imported Fiber Content 100% polyester Care Machine wash cold

Zoom
Bell Get Sale Alert

Free Shipping

BCBGMAXAZRIA Urban Jungle Banks Cargo Romper BCBGMAXAZRIA Urban Jungle Banks Cargo Romper More Info Product cell

From the Urban Jungle Collection. Classic cargo romper adds a utilitarian vibe. Mandarin collar. Shoulder epaulettes. Button cuffed sleeves. Front button closure. Chest patch pockets. Waist slash pockets. Back box pleated yoke. Back shirttail hem. Folded hem. About 18" from shoulder to hem. Rise, about 11".Inseam, about 6".Lyocell twill. Machine wash. Imported. Model shown is 5'10" (177cm) wearing US size 4.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Linn Crossover Lace Romper BCBGMAXAZRIA Women's Linn Crossover Lace Romper More Info Product cell

Withasymmetricallaceblockingandtailoredfrontpleats,hisprettyplaysuitmakesafresh,femininestatement

Zoom
Bell Get Sale Alert

Free Shipping any 2+ items

BCBGMAXAZRIA Linn Crossover Lace Rompers BCBGMAXAZRIA Linn Crossover Lace Rompers More Info Product cell

Steal the show in this lovely BCBGMAXAZRIA romper. ; Feminine romper flaunts crossover detailing at front with sheer lace accents for a luxe look. ; Round neckline and sleeveless construction. ; V-back with zip closure. ; Banded waist flatters your figure. ; Pleated detailing at short shorts. ; 65% polyester, 33% rayon, 5% spandex. ; Hand wash cold, hang dry. ; Imported. Measurements: ; Inseam: 30 in ; Product measurements were taken using size SM (US 4). Please note that measurements may vary by size.

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Banks Woven Romper BCBGMAXAZRIA Women's Banks Woven Romper More Info Product cell

Shoulderepaulettes,cargopocketsandafrontbuttonplacketaddautilitarianvibetocasualchic.Plus,itsstretchwaistbandupstheeaseforall-daycomfort.

Zoom
Bell Get Sale Alert

Free Ship $99+: SHIP99

BCBGMAXAZRIA Sleeveless Lace Short Jumpsuit BCBGMAXAZRIA Sleeveless Lace Short Jumpsuit More Info Product cell

Lace panels add to the feminine appeal of this pair Crewneck Sleeveless Front darts Banded hem Front zip fly Dual side slash pockets V-back Concealed back zip closure Dual back darts About 30.5" from shoulder to hem Rise, about 12.2" Inseam, about 2" Leg opening, about 24" Polyester Self: Polyester/spandex Contrast: Nylon Hand wash Imported Model shown is 5'10" (177cm) wearing US size 4

Zoom
Bell Get Sale Alert

BCBGMAXAZRIA Women's Kailee Short BCBGMAXAZRIA Women's Kailee Short More Info Product cell

Lightweightandlaid-back,thisstatementpairfeaturesornateblossomsinon-trendhuesofblueandastretchwaistbandthatensuresalldaycomfort.

Zoom
Bell Get Sale Alert
BCBGMAXAZRIA Women's Shorts - ShopStyle