Women Bags Shoes Beauty Jewelry Men Kids Home Offers Sale Editors' Blog Featured Looks

Alpha Industries Women's Fashion

75 Products
Sort

Free Shipping & Returns

Alpha Industries Women's "Hawaii" Reversible Flight Jacket Alpha Industries Women's "Hawaii" Reversible Flight Jacket More Info Product cell

Alpha Industries' flight jacket features two multicolored embroidered flowers at the front and red "Hawaii" lettering and a multicolored hula-girl motif at the back. The jacket reverses from black tech fabric to red tech fabric. Signature "Remove Before Flight" key chain. Logo fabric tag at sleeve. Logo patch and Barneys XO logo patch on placket at reverse. Striped rib-knit stand shawl collar, cuffs, bottom. Raglan sleeves. Zip utility pocket at left sleeve. Snap welt side pockets. Silvertone hardware. Reverse: snap welt side pockets. 22.75" center back length (approximately). Two-way zip-front closure. Available in Black/Red/Multi. 100% nylon. Lining: 100% nylon. Dry clean. Imported.;NYLON

Zoom
Bell Get Sale Alert

Up to 50% off! Free Ship

Alpha Industries Elyse Faux Fur Parka Alpha Industries Elyse Faux Fur Parka More Info Product cell

Since setting up shop in 1959, Alpha Industries has supplied men with the best in military-inspired fashion. Formerly manufacturers of flight and terrain jackets for the Department of Defense, these Alpha Industries takes their technologies and soldier style to better suit the everyday guy. Shell & Lining: 100% nylonFilling: 100% polyFaux fur hood lining: 56% acrylic, 44% polyFaux fur hood trim: 65% acrylic, 35% polyKnit: 100% poly Dry clean only Front zipper with button closure Side snap buttoned flap pockets Attached hood with faux fur lining and detachable contrast faux fur trim Drawstring waist.

Zoom
Bell Get Sale Alert

Free Shipping & Returns

Alpha Industries Women's MA-1 Reversible Flight Jacket Alpha Industries Women's MA-1 Reversible Flight Jacket More Info Product cell

Fashioned after the jackets worn by 1950s U.S. Air Force and Navy pilots, Alpha Industries' MA-1 flight jacket is embroidered at the front and back with koi. The jacket reverses from cream and mauve tech fabric to cream tech fabric. Signature "Remove Before Flight" key chain. Logo fabric tag at sleeve. Logo patch and Barneys XO logo patch on placket at reverse. Slim fit. Striped rib-knit collar, cuffs, bottom band. Long raglan sleeves. Utility pocket at sleeve. Snap hand-warmer pockets. Brushed silvertone zipper. Reverse: Locker loop at nape. Snap hand-warmer pockets. Zip-front closure. Available in Cream/Mauve. 100% nylon. Rib-knit: 99% polyester, 1% spandex. Dry clean. Imported. Our model is 5'10"/178cm and wearing a size Small.;NYLON

Zoom
Bell Get Sale Alert

Free Shipping & Returns

Alpha Industries Women's MA-1 Reversible Flight Jacket Alpha Industries Women's MA-1 Reversible Flight Jacket More Info Product cell

Fashioned after the jackets worn by 1950s U.S. Air Force and Navy pilots, Alpha Industries' MA-1 flight jacket is embroidered at the front and back with multicolored cherry blossoms. The jacket reverses from cream and blue tech fabric to cream tech fabric. Signature "Remove Before Flight" key chain. Logo fabric tag at sleeve. Logo patch and Barneys XO logo patch on placket at reverse. Slim fit. Striped rib-knit collar, cuffs, bottom band. Long raglan sleeves. Utility pocket at sleeve. Snap hand-warmer pockets. Brushed silvertone zipper. Reverse: Locker loop at nape. Snap hand-warmer pockets. Zip-front closure. Available in Cream/Blue. 100% nylon. Rib-knit: 99% polyester, 1% spandex. Dry clean. Imported. Our model is 5'10"/178cm and wearing a size Small.;NYLON

Zoom
Bell Get Sale Alert

Free Shipping & Returns

Alpha Industries Women's L-2B Flex Jacket Alpha Industries Women's L-2B Flex Jacket More Info Product cell

Fashioned after the jackets worn by 1950s U.S. Air Force and Navy pilots, Alpha Industries' olive tech-fabric L-2B Flex jacket includes five Alpha Industries patches and six Ball & Chain Co. patches designed to attach to the hook-and-loop patches at the chest and sleeves. Signature "Remove Before Flight" key chain. Includes six Ball & Chain Co. embroidered patches. Slim fit. Rib-knit collar, cuffs, bottom band. Utility pocket at sleeve. Snap hand-warmer pockets. Silvertone zipper. Two-way zip-front closure. Lined with orange tech fabric. Available in Olive. 100% nylon. Rib-knit: 99% polyester, 1% spandex. Fill: 100% polyester. Machine wash. Imported. Our model is 5'10"/178cm and wearing a size Small.;NYLON

Zoom
Bell Get Sale Alert

Up to 50% off! Free Ship

Alpha Industries Elyse Faux Fur Parka Alpha Industries Elyse Faux Fur Parka More Info Product cell

Since setting up shop in 1959, Alpha Industries has supplied men with the best in military-inspired fashion. Formerly manufacturers of flight and terrain jackets for the Department of Defense, these Alpha Industries takes their technologies and soldier style to better suit the everyday guy. Shell & Lining: 100% nylonFilling: 100% polyFaux fur hood lining: 56% acrylic, 44% polyFaux fur hood trim: 65% acrylic, 35% polyKnit: 100% poly Dry clean only Front zipper with button closure Side snap buttoned flap pockets Attached hood with faux fur lining and detachable contrast faux fur trim.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries bomber jacket Alpha Industries bomber jacket More Info Product cell

White nylon bomber jacket from Alpha Industries featuring long sleeves, knit collar, cuffs and waistband, two snap-closure hand pockets and "Remove Before Flight" ribbon keychain.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries cropped bomber jacket Alpha Industries cropped bomber jacket More Info Product cell

Blue cropped bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries bomber jacket Alpha Industries bomber jacket More Info Product cell

Black bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Free Shipping & Returns

Alpha Industries MA-1 Diamond W Bomber Alpha Industries MA-1 Diamond W Bomber More Info Product cell

Since setting up shop in 1959, Alpha Industries has supplied men with the best in military-inspired fashion. Formerly manufacturers of flight and terrain jackets for the Department of Defense, these Alpha Industries takes their technologies and soldier style to better suit the everyday guy. Shell & Lining: 100% nylonFilling: 100% polyKnit: 99% poly, 1% spandex Hand wash cold Front zipper closure Side snap buttoned welt pockets Zippered sleeve pocket Ribbed trim.

Zoom
Bell Get Sale Alert

Up to 50% off! Free Ship

Alpha Industries B-15 Slim Fit Bomber with Faux Fur Collar Alpha Industries B-15 Slim Fit Bomber with Faux Fur Collar More Info Product cell

Since setting up shop in 1959, Alpha Industries has supplied men with the best in military-inspired fashion. Formerly manufacturers of flight and terrain jackets for the Department of Defense, these Alpha Industries takes their technologies and soldier style to better suit the everyday guy. Shell & Lining: 100% nylonFilling: 100% polyKnit: 99% poly, 1% spandexFaux fur collar: 100% acrylicKnitted bottom band: 99% poly, 1% spandex Dry clean only Front zipper closure Side snap buttoned welt pockets Contrast ribbed trim Zippered sleeve pocket Detachable faux fur trim.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries cropped bomber jacket Alpha Industries cropped bomber jacket More Info Product cell

Black cropped bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries arm pocket bomber jacket Alpha Industries arm pocket bomber jacket More Info Product cell

Blue arm pocket bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. Two snap button pockets . One zip sleeve pocket with tag. One internal pocket . Slim fit. Sample size: L

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries arm pocket bomber jacket Alpha Industries arm pocket bomber jacket More Info Product cell

Nude arm pocket bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Slim fit. Sample size: S

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Cropped Bomber Jacket Alpha Industries Slim Fit Nylon Cropped Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Slim fit. Cropped . Sample size: S

Zoom
Bell Get Sale Alert

Extra 20% Off: LIT20

Alpha Industries MA-1 TT Bomber Jacket Alpha Industries MA-1 TT Bomber Jacket More Info Product cell

Bomber jacket by Alpha Industries, Smooth woven fabric, Baseball collar, Zip fastening, Functional pockets, Ribbed trims, Regular fit - true to size, Dry clean, 65% Nylon, 35% Polyester, Our model wears a UK S/EU S/US XS and is 176cm/5'9.5 tall. The premier supplier of tough wearing jackets for the U.S. military; Alpha Industries' quality manufacturing expertise has soon developed into a worldwide fashion brand. Tried, tested and proven; Alpha Industries prides itself on cutting-edge design and superior quality. Known for their flight and field jackets, fishtail parkas and trench coats retain authentic signature style.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries arm pocket bomber jacket Alpha Industries arm pocket bomber jacket More Info Product cell

Blue arm pocket bomber jacket from Alpha Industries.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B FLEX JACKET Alpha Industries L-2B FLEX JACKET More Info Product cell

Army green L-2B FLEX JACKET from Alpha Industries featuring a ribbed collar, long sleeves, front snap button pockets, a ribbed hem and cuffs, is reversible, five patches and signature zippered pencil pocket with “Remove Before Flight” keychain on the sleeve. This item is unisex.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B Flex Jacket Alpha Industries L-2B Flex Jacket More Info Product cell

Army green L-2B Flex Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, 5 patches and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag .

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B Long Jacket Alpha Industries L-2B Long Jacket More Info Product cell

Black L-2B Long Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, ribbed cuffs, a mid-calf length and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B SCOUT Jacket Alpha Industries L-2B SCOUT Jacket More Info Product cell

Black L-2B SCOUT Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, a ribbed hem and cuffs and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B FLEX JACKET Alpha Industries L-2B FLEX JACKET More Info Product cell

Black L-2B FLEX JACKET from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, a ribbed hem and cuffs and signature zippered pencil pocket with the “Remove Before Flight” tag. This item is unisex.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B Hooded Jacket Alpha Industries L-2B Hooded Jacket More Info Product cell

Black L-2B Hooded Jacket from Alpha Industries featuring hooded, a front zip fastening, long sleeves, front snap button pockets, a ribbed hem and cuffs and signature zippered pencil pocket with “Remove Before Flight” keychain on the sleeve. This item is unisex.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B SCOUT Jacket Alpha Industries L-2B SCOUT Jacket More Info Product cell

Army green L-2B SCOUT Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, a ribbed hem and cuffs and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag. .

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries L-2B Long Jacket Alpha Industries L-2B Long Jacket More Info Product cell

Army green L-2B Long Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, ribbed cuffs, a mid-length and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries Souvenir Tiger Jacket Alpha Industries Souvenir Tiger Jacket More Info Product cell

Gold tone Souvenir Tiger Jacket from Alpha Industries featuring a ribbed collar, a front zip fastening, long sleeves, front snap button pockets, a ribbed hem and cuffs, embroidered details and signature zippered pencil pocket with the “Remove Before Flight” tag. This item is unisex.

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries Diplomat Fishtail parka Alpha Industries Diplomat Fishtail parka More Info Product cell

Army green cotton Diplomat Fishtail parka from Alpha Industries featuring a hood with drawstring tie fastenings, a button over front zip fastening, long sleeves, front pockets, a back snap button closure and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag. .

Zoom
Bell Get Sale Alert

Free Shipping

Alpha Industries Diplomat Fishtail parka Alpha Industries Diplomat Fishtail parka More Info Product cell

Black cotton Diplomat Fishtail parka from Alpha Industries featuring a hood with drawstring tie fastenings, a front button fastening, a snap fastening, long sleeves, front flap pockets, a back snap button closure and Alpha’s signature zippered pencil pocket with the “Remove Before Flight” tag. .

Zoom
Bell Get Sale Alert

Alpha Industries MA-1 shell bomber jacket Alpha Industries MA-1 shell bomber jacket More Info Product cell

Founded in 1957, all American label Alpha Industries set about creating authentic flight jackets for its eclectic clientele. Six decades on and the notion remains the same, only reconditioned to reflect the season's current trends. For SS17 the bomber jacket dominated, here the MA 1 design adopts the lauded silhouette and spins it with a satin exterior, punched with a zip pocket at the sleeve to hark on the traditional surplus details.Alpha Industries shell bomber jacketExposed zip fastening at frontStand collar, long sleeves, one zip pocket at sleeve with branded pull, two popper fastened welt pockets at front, rose gold hardware, darts at back yoke, ribbed trims, one interior pocket, fully lined100% nylon; lining 100% nylonDry cleanSize small: Length 24"Model is 5ft 10" and wears a size small

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Slim fit . Sample size: S

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Slim fit . Sample size: S

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Slim fit . Sample size: S

Zoom
Bell Get Sale Alert

Up to 50% off: BIG

Alpha Industries Slim Fit Nylon Bomber Jacket Alpha Industries Slim Fit Nylon Bomber Jacket More Info Product cell

Ribbed collar, cuffs and hem. Front zip closure. One zip sleeve pocket with tag. Two side snap button pockets . Two internal pockets . Slim fit. Sample size: M

Zoom
Bell Get Sale Alert

Alpha Industries Women's L-2b Scout W Alpha Industries Women's L-2b Scout W More Info Product cell

WantthatclassicbomberjacketlookwithoutthebulkTheL-2BScoutisyouranswer.InspiredbytheclassicL-2Bweproducedforthemilitary,thislightweightvariationfeaturesamattenylonshellwithanylonliningthatisreversibletoEmergencyOrangewiththeexceptionoftheVintageWhitecolorway.Itdeliversbreathabilityandwaterresistanceforthewarmertemperaturesofspring.

Zoom
Bell Get Sale Alert

Free Ship & Free Return

Alpha Industries Elyse Parka Women's Jacket Alpha Industries Elyse Parka Women's Jacket More Info Product cell

; The first N-3B jackets were produced in the mid 1950s for USAF air crews who were assigned to transport troops in extremely cold climates. The long sage green jackets became known as the Snorkel Parka because the fur-trimmed hood could be zipped right up leaving only a small tunnel for the wearer to look out of. The modern N-3Bs have slant pockets at the chest and flap pockets lower on the coat, and a panel that fastens with loops across the zipper to keep out wind. Today, most use synthetic fur around the hood. The N-3B was the first jacket Alpha Industries made for the U.S. government in 1959. ; N-3B-inspired parka sports a water-resistant flight nylon shell. ; Standard fit. ; Partial faux rabbit fur lining from the hood to the waist. ; Snorkel hood has removable faux fur trim. ; Hidden zip front and tortoiseshell button-and-loop placket. ; Snap-flap hand pockets. ; Signature zipper utility/pencil pocket on sleeve with red Remove Before Flight tag. ; Rib knit inset cuffs. ; Interior drawstring waist. ; Polyester fill. ; Heavyweight construction offers protection against sub-freezing weather conditions. ; Inner pocket. ; Style #WJE45500C1. ; 100% nylon; Fill: 100% polyester; Knit: 100% polyester; Faux fur inside hood: 56% acrylic, 44% polyester; Faux fur on hood edge: 65% acrylic, 35% polyester. ; Dry clean. ; Imported. Measurements: ; Length: 36 in ; Product measurements were taken using size XS. Please note that measurements may vary by size.

Zoom
Bell Get Sale Alert

Alpha Industries MA-1 shell bomber jacket Alpha Industries MA-1 shell bomber jacket More Info Product cell

Founded in 1957, all American label Alpha Industries set about creating authentic flight jackets for its eclectic clientele. Six decades on and the notion remains the same, only reconditioned to reflect the season's current trends. For SS17 the bomber jacket dominated, here the MA 1 design adopts the lauded silhouette and spins it with a shell exterior, punched with a zip pocket at the sleeve to hark on the traditional surplus details.Alpha Industries shell bomber jacketConcealed zip fastening at frontStand collar, long sleeves, one zip pocket at sleeve with branded pull, two popper fastened welt pockets at front, darts at back yoke, ribbed trims, one interior pocket, fully lined100% nylon; lining 100% nylon; quilting 100% polyesterDry cleanSize small: Length 23"Model is 5ft 10" and wears a size small

Zoom
Bell Get Sale Alert

Alpha Industries Women's Ma-1 Flight Nylon Reversible Bomber Jacket Alpha Industries Women's Ma-1 Flight Nylon Reversible Bomber Jacket More Info Product cell

Ourpopularma-1flightjacketisnowavailableforwomen.Amid-weightnylonwithwaterresistanceandscadsofversatility,thema-1navyfighterpilotjacketwasthefirstmilitaryflightjackettocrossoverintocivilianfashion.Ournylonflightjacketincludesknitcuffs,aknitcollarandwaistband,aswellasastormflapforwarmth.Therearemultiplesnap-closurepocketsaswellasthesignaturealphazipperedutility/pencilpocketwiththe"removebeforeflight"keychain.Ourma-1flightjacketsarereversibletobrightorange,makingthemidealforrescuemissionsandothertimeswhenvisibilityisimperative.Alphaindustriesisa55-year-oldheritagemilitarycompanythatoriginallysuppliedtheunitedstatesarmedforceswithdurableouterwear.NowyoucanownanauthenticflightjacketmadetothesamehighqualitystandardsdemandedbytheUSmilitary.Eachflightjacketisuniquelydesignedandinspiredbyaniconicmilitaryjacketinalphaindustrieshistory.WeinviteyoutobeapartofthishistorytodayKeywords:ma-1,bomberjacket,flightjacket,militaryjackets,alphaindustries,ladiesjackets,women'souterwear

Zoom
Bell Get Sale Alert

Free Ship & Free Return

Alpha Industries L-2B Scout Jacket Women's Coat Alpha Industries L-2B Scout Jacket Women's Coat More Info Product cell

; The L-2B flight jacket was introduced in the early 1950s as a bomber jacket used specifically by the USAF. The flight jacket went through many specification updates including the removal of the oxygen tab, snap tabs and epaulets, along with the USAF logo as the jacket was eventually adopted by the Navy and other branches of the armed forces. The L-2B Scout Jacket brings the iconic look into contemporary era with lightweight, street-ready style. ; Lightweight bomber jacket is suitable for protection in temperatures above 40° F. ; Lightweight nylon shell offers water-resistant protection. ; Rib-knit collar. ; Full-length zip with inner draft flap. ; Long sleeves with rib-knit cuffs. ; Snap-flap hand pockets. ; Inner snap-button pockets. ; Utility and pen pocket at the left sleeve with signature Remove Before Flight tag. ; Rib-knit hemline. ; Tonal logo embroidery at the inner draft flap. ; Full inner lining with high-visibility orange available in Black or Sage. ; Style #WJL46000C1. ; Body: 100% nylon; Knit: 67% polyester, 33% spandex; Lining: 100% nylon. ; Machine wash and tumble dry. ; Imported. Measurements: ; Length: 23 in ; Product measurements were taken using size SM. Please note that measurements may vary by size.

Zoom
Bell Get Sale Alert